SPINK6 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPINK6

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine protease inhibitor Kazal-type 6

Protein Size: 80

Purification: Affinity Purified

• Artikelnummer: AVIARP55978_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55978_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 404203
• Wirt: Rabbit