SPINT2 Antibody - middle region : FITC

SPINT2 Antibody - middle region : FITC
Artikelnummer
AVIARP59164_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPINT2

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: RWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kunitz-type protease inhibitor 2

Protein Size: 195

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59164_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59164_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10653
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×