SPINT2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPINT2

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: RWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kunitz-type protease inhibitor 2

Protein Size: 195

Purification: Affinity Purified

• Artikelnummer: AVIARP59164_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59164_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10653
• Wirt: Rabbit
• Konjugat: Conjugated, HRP