SPTAN1 Antibody - N-terminal region : HRP

SPTAN1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58532_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPTAN1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 272kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spectrin alpha chain, non-erythrocytic 1

Protein Size: 2472

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58532_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58532_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 6709
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×