Srgap1 Antibody - middle region : Biotin

Srgap1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57446_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SLIT-ROBO Rho GTPase-activating protein 1

Protein Size: 714

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57446_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57446_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 117600
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×