Srpx Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: ALALQLRLLLRIPLYSFSMVVVDKHGMDKERYVSLVTPMALFNLIDTFPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sushi-repeat-containing protein SRPX

Protein Size: 464

Purification: Affinity Purified

• Artikelnummer: AVIARP58956_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58956_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51795
• Wirt: Rabbit
• Konjugat: Conjugated, HRP