SSX1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune respo

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSX1

Key Reference: Tornkvist,M., (2008) Biochem. Biophys. Res. Commun. 368 (3), 793-800

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein SSX1

Protein Size: 188

Purification: Affinity Purified

• Artikelnummer: AVIARP57900_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57900_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6756
• Wirt: Rabbit