STIMATE Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM110

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: store-operated calcium entry regulator STIMATE

Protein Size: 294

Purification: Affinity Purified

• Artikelnummer: AVIARP55905_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55905_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 375346
• Wirt: Rabbit