STK17A Antibody - C-terminal region : Biotin

STK17A Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58888_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STK17A

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase 17A

Protein Size: 414

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58888_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58888_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9263
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×