Stmn1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Stmn1 is involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Stmn1 prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Stmn1 is involved in the control of the learned and innate fear.

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Stathmin

Protein Size: 149

Purification: Affinity Purified

• Artikelnummer: AVIARP58670_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58670_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 16765
• Wirt: Rabbit
• Konjugat: Conjugated, FITC