SUMO3 Antibody - middle region : Biotin

SUMO3 Antibody - middle region : Biotin
Artikelnummer
AVIARP58247_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUMO3

Key Reference: Zhang,X.D., (2008) Mol. Cell 29 (6), 729-741

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Small ubiquitin-related modifier 3

Protein Size: 103

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58247_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58247_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6612
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×