SYCP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYCP1

Key Reference: Neumann,F., (2005) Blood 106 (9), 3105-3113

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptonemal complex protein 1

Protein Size: 976

Purification: Affinity Purified

• Artikelnummer: AVIARP58330_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58330_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 6847
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin