SYCP3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SYCP3

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptonemal complex protein 3

Protein Size: 236

Purification: Affinity Purified

• Artikelnummer: AVIARP58335_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58335_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 50511
• Wirt: Rabbit
• Konjugat: Conjugated, FITC