SYCP3 Antibody - N-terminal region : HRP

SYCP3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58335_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SYCP3

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Synaptonemal complex protein 3

Protein Size: 236

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58335_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58335_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50511
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×