Tau-383 (0N4R) Wild-Type Monomers

Human Recombinant Tau-383 (0N4R) Wild-Type Monomers
Artikelnummer
STRSPR-509B
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Tau-383 (0N4R)

Nature: Recombinant

Swiss-Prot: P10636-6

Expression System: E. coli

Protein Length: 383 aa

Amino Acid Sequence: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Purification: Ion-exchange Purified

Purity: >95%

Storage Buffer: 10mM Hepes pH 7.4, 100mM NaCl

Protein Size: 40.007 kDa

Conjugate: No Tag

Scientific Background: Several tau isoforms, including 0N4R, are expressed in the human brain, and the existence of multiple human tauopathies with distinct fibril morphologies suggests different molecular conformers incorporating different isoforms may exist (1, 2). NMR data indicates that both 3R and 4R tau are incorporated into AD-tau seeded fibrils (3).

References: 1. Goedert et al. 1989. Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer’s disease. Neuron. DOI: 10.1016/0896-6273(89)90210-92. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annual Review of Neuroscience. DOI: 10.1146/annurev-neuro-072116-0311533. Dregni et al. 2022. Fluent molecular mixing of Tau isoforms in Alzheimer’s disease neurofibrillary tangles. Nature communications. DOI: 10.1038/s41467-022-30585-0

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-509B
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-509B
Verpackungseinheit 100 µg
Mengeneinheit STK
Reaktivität Human
Methode Western Blotting, SDS-PAGE
Produktinformation (PDF) Download
MSDS (PDF) Download