Tau-441 (2N4R) and Alpha Synuclein Co-Polymer Fibrils

Human Recombinant Tau-441 (2N4R) and Human Recombinant Alpha Synuclein Co-Polymer Fibrils
Artikelnummer
STRSPR-495E
Verpackungseinheit
5x100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Tau and Alpha Synuclein Co-Polymer

Nature: Recombinant

Swiss-Prot: P10636-8 and P37840-1

Biological Activity:

Expression System: E. coli

Protein Length: Full Length (Tau 2N4R: 1-441 aa, ASYN: 1-140 )

Amino Acid Sequence: Tau:MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGLAsyn: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Purification: Ion-exchange Purified

Purity: >95%

Storage Buffer: 1X PBS pH 7.4

Protein Size: 2N4R: 45.84 kDa, ASYN: 14.46 kDa

Conjugate: No Tag

Cellular Localization:

Scientific Background: Brain-specific tau isoforms vary in the number of N-terminal inserts and C- terminal repeat domains due to alternative splicing of exons; the 2N4R isoform of tau is expressed in adult brain yet is absent from the fetal brain (1). Tau and alpha-synuclein polymerize into amyloid fibrils to form filamentous inclusions in neurodegenerative diseases such as Alzheimer’s and Parkinson’s disease. Tau has been shown to interact with alpha-synuclein in vitro (2), with synergistic cross-seeding between tau and alpha-synuclein resulting in polymerization of each other into fibrillary amyloid lesions in neuronal cultures and in vivo (3,4). Recombinant tau and alpha-synuclein co-polymer fibrils have demonstrated a more widespread transmission of induced pathology in a rodent model of tauopathies compared to pure Tau or alpha-synuclein fibrils alone (5). These co-polymer fibrils have also shown enhanced alpha-synuclein aggregation in vitro, and more severe alpha-synuclein pathology and Parkinson’s disease-like symptoms in mice (6).

References: 1. Goedert et al. Multiple Isoforms of Human Microtubule-associated Protein Tau: Sequences and Localization in Neurofibrilary Tangles of Alzheimer’s Disease. Neuron. 1989;3(4):519-526.2. Jensen et al. α-synuclein Binds to Tau and Stimulates the Protein Kinase A-catalyzed Tau Phosphorylation of Serine Residues 262 and 356. 1999. JBC. 274(36): 25481-25489. DOI:https://doi.org/10.1074/jbc.274.36.254813. Giasson et al. Initiation and Synergistic Fibrillization of Tau and Alpha-Synuclein. Science. 2003; 300: 636-40. DOI: 10.1126/science.10823244. Guo et al. Distinct α-synuclein Strains Differentially Promote Tau Inclusions in Neurons. 2013. Cell. 154(1) doi:10.1016/j.cell.2013.05.057.5. Williams et al. Differential Cross-seeding Properties of Tau and α-synuclein in Mouse Models of Tauopathy and Synucleinopathy. Brain Communications. 2020; 2(2):fcaa090. doi:10.1093/braincomms/fcaa0906. Pan et al. Tau Accelerates α-synuclein Aggregation and Spreading in Parkinson’s Disease. 2022. Brain. Doi: 10.1093/brain/awac171

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-495E
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-495E
Green Labware Nein
Verpackungseinheit 5x100 µg
Mengeneinheit PAK
Reaktivität Human
Methode Western Blotting, SDS-PAGE
Produktinformation (PDF) Download
MSDS (PDF) Download