Tau dGAE (297-391) AD-mimic Pre-formed Fibrils

Human Recombinant Tau dGAE (297-391) AD-mimic Pre-formed Fibrils (fibrilized without heparin)
Artikelnummer
STRSPR-502XE
Verpackungseinheit
500 µg (@5mg/ml)
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Tau dGAE (AA297-391)

Nature: Recombinant

Swiss-Prot: P10636-8

Expression System: E. coli

Protein Length: Fragment of full length wild-type Tau 2N4R (297 - 391aa)

Amino Acid Sequence: IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE

Purification: Ion-exchange Purified

Purity: >95%

Storage Buffer: 10mM PB pH 7.4, 10mM DTT, 200mM MgCl2

Protein Size: 10.165 kDa

Conjugate: No Tag

Scientific Background: Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer’s disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold – i.e. an AD-isolated Tau filaments’ fold is distinct from a CTE-isolated Tau filaments’ fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq’s catalog# SPR-502 Tau dGAE (297-391) AD-mimic PFFs are purified and fibrilized under these exact published conditions that replicate the disease-isolated AD-fold (200 rpm at 37oC in 10 mM PB 10 mM DTT pH 7.4 200 mM MgCl2 for 48 hours).

References: 1. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annu Rev Neurosci. DOI: https://doi.org/10.1146/annurev-neuro-072116-0311532. Fitzpatrick et al. 2017. Cryo-EM structures of tau filaments from Alzheimer’s disease. Nature. DOI: 10.1038/nature230023. Falcon et al. 2019. Novel tau filament fold in chronic traumatic encephalopathy encloses hydrophobic molecules. Nature. DOI: https://doi.org/10.1038/s41586-019-1026-5.4. Lovestam et al. 2022. Assembly of Recombinant Tau into Filaments Identical to those of Alzheimer’s disease and Chronic Traumatic Encephalopathy. eLife. DOI: https://doi.org/10.7554/eLife.764945. Lovestam et al. 2023. Disease-specific Tau Filaments Assemble via Polymorphic Intermediates. bioRxiv. https://doi.org/10.1101/2023.07.24.550295

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-502XE
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-502XE
Verpackungseinheit 500 µg (@5mg/ml)
Mengeneinheit STK
Reaktivität Human
Methode Western Blotting, In Vivo Assay
Produktinformation (PDF) Download
MSDS (PDF) Download