TBC1D13 Antibody - middle region : Biotin

TBC1D13 Antibody - middle region : Biotin
Artikelnummer
AVIARP58536_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D13

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 13

Protein Size: 400

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58536_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58536_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54662
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×