TBC1D13 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D13

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 13

Protein Size: 400

Purification: Affinity Purified

• Artikelnummer: AVIARP58536_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58536_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54662
• Wirt: Rabbit
• Konjugat: Conjugated, FITC