Tbc1d7 Antibody - C-terminal region : Biotin

Tbc1d7 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56927_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Tbc1d7 is a component of the TSC-TBC complex, that contains TBC1D7 in addition to the TSC1-TSC2 complex and consists of the functional complex possessing GTPase-activating protein (GAP) activity toward RHEB in response to alterations in specific cellular growth conditions. The small GTPase RHEB is a direct activator of the protein kinase activity of mTORC1 and the TSC-TBC complex acts as a negative regulator of mTORC1 signaling cascade by acting as a GAP for RHEB. Participates in the proper sensing of growth factors and glucose, but not amino acids, by mTORC1. It is unclear whether TBC1D7 acts as a GTPase-activating protein and additional studies are required to answer this question.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tbc1d7

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 7

Protein Size: 293

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56927_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56927_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 67046
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×