TBC1D7 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TBC1D7 belongs to a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2, yeast Bub2, and CDC16.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D7

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MYQLESGKLPRSPSFPLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 7

Protein Size: 247

Purification: Affinity Purified

• Artikelnummer: AVIARP56926_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56926_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51256
• Wirt: Rabbit