TCL1A Antibody - N-terminal region : Biotin

TCL1A Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58808_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3;promote nuclear translocation of AKT1;enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCL1A

Key Reference: Herling,M., (2008) Blood 111 (1), 328-337

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell leukemia/lymphoma protein 1A

Protein Size: 114

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58808_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58808_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8115
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×