Tdp1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Tdp1 is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. It hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. It acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. It has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. It has no exonuclease activity towards DNA or RNA with a 3'phosphate.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 579

Purification: Affinity Purified

• Artikelnummer: AVIARP57199_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57199_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 104884
• Wirt: Rabbit