TEDC1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human C14orf80

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tubulin epsilon and delta complex protein 1

Protein Size: 248

Purification: Affinity Purified

• Artikelnummer: AVIARP55661_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55661_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 283643
• Wirt: Rabbit