TESC Antibody - C-terminal region : HRP

TESC Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57060_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+ exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane and promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner and inhibits the phosphatase activity of calcineurin.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TESC

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcineurin B homologous protein 3

Protein Size: 214

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57060_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57060_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54997
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×