TEX9 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEX9

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: VSNDIGTEAQIRFLKAKLHVMQEELDNVVCECNKKEDEIQNLKSQVKNFE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: testis-expressed sequence 9 protein

Protein Size: 316

Purification: Affinity Purified

• Artikelnummer: AVIARP55895_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55895_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 374618
• Wirt: Rabbit