TEX9 Antibody - middle region : HRP

TEX9 Antibody - middle region : HRP
Artikelnummer
AVIARP55895_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEX9

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: VSNDIGTEAQIRFLKAKLHVMQEELDNVVCECNKKEDEIQNLKSQVKNFE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: testis-expressed sequence 9 protein

Protein Size: 316

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55895_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55895_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374618
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×