English
TFAP2B Antibody - N-terminal region : HRP
TFAP2B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57907_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes. This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AU141084.1 1-144 145-1684 BC037225.1 1-1540 1685-5370 AL049693.16 11928-15613 5371-5770 BU738725.1 18-417 c
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2B
Key Reference: Hensch,T., (2008) Neurosci. Lett. 436 (1), 67-71
Molecular Weight: 50kDa
Peptide Sequence: Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Transcription factor AP-2-beta
Protein Size: 460
Purification: Affinity Purified
Description of Target: TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes. This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AU141084.1 1-144 145-1684 BC037225.1 1-1540 1685-5370 AL049693.16 11928-15613 5371-5770 BU738725.1 18-417 c
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2B
Key Reference: Hensch,T., (2008) Neurosci. Lett. 436 (1), 67-71
Molecular Weight: 50kDa
Peptide Sequence: Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Transcription factor AP-2-beta
Protein Size: 460
Purification: Affinity Purified
| Artikelnummer | AVIARP57907_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57907_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 7021 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
