TFDP3 Antibody - middle region : FITC

TFDP3 Antibody - middle region : FITC
Artikelnummer
AVIARP58171_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFDP3

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor Dp family member 3

Protein Size: 345

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58171_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58171_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51270
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×