TFDP3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP3

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor Dp family member 3

Protein Size: 345

Purification: Affinity Purified

• Artikelnummer: AVIARP58170_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58170_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51270
• Wirt: Rabbit