TGFB3 Antibody - middle region : Biotin

TGFB3 Antibody - middle region : Biotin
Artikelnummer
AVIARP59157_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TGFB3 is involved in embryogenesis and cell differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGFB3

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transforming growth factor beta-3

Protein Size: 412

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59157_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59157_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 7043
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×