TGFB3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TGFB3 is involved in embryogenesis and cell differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGFB3

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transforming growth factor beta-3

Protein Size: 412

Purification: Affinity Purified

• Artikelnummer: AVIARP59157_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59157_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 7043
• Wirt: Rabbit
• Konjugat: Conjugated, HRP