TH1L Antibody - N-terminal region : FITC

TH1L Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57805_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The NELF complex of proteins interacts with the DSIF protein complex to repress transcriptional elongation by RNA polymerase II. The protein encoded by this gene is an essential part of the NELF complex. Alternative translation initiation site usage results in the formation of two isoforms with different N-termini.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TH1L

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Negative elongation factor C/D

Protein Size: 590

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57805_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57805_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51497
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×