Thap11 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Thap11 is a rranscriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. It is also a sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers.

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: AAECTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: THAP domain-containing protein 11

Protein Size: 305

Purification: Affinity Purified

• Artikelnummer: AVIARP58803_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58803_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 59016
• Wirt: Rabbit
• Konjugat: Conjugated, FITC