THNSL2 Antibody - middle region : Biotin

THNSL2 Antibody - middle region : Biotin
Artikelnummer
AVIARP57188_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: THNSL2 acts as a catabolic phospho-lyase on both gamma- and beta-phosphorylated substrates.THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THNSL2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Threonine synthase-like 2

Protein Size: 484

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57188_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57188_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55258
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×