THPO Antibody - middle region : FITC

THPO Antibody - middle region : FITC
Artikelnummer
AVIARP58735_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THPO

Key Reference: Baker,J.E., (2008) Cardiovasc. Res. 77 (1), 44-53

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thrombopoietin

Protein Size: 353

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58735_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58735_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7066
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×