English
THYN1 Antibody - middle region : FITC
THYN1 Antibody - middle region : FITC
Artikelnummer
AVIARP54988_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THYN1
Key Reference: Song,A.X., (2005) Protein Expr. Purif. 42 (1), 146-152
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Thymocyte nuclear protein 1
Protein Size: 225
Purification: Affinity Purified
Description of Target: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THYN1
Key Reference: Song,A.X., (2005) Protein Expr. Purif. 42 (1), 146-152
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Thymocyte nuclear protein 1
Protein Size: 225
Purification: Affinity Purified
| Artikelnummer | AVIARP54988_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54988_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 29087 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
