TIMP4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TIMP4

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Metalloproteinase inhibitor 4

Protein Size: 224

Purification: Affinity Purified

• Artikelnummer: AVIARP59185_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59185_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7079
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin