TINAG Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAG

Molecular Weight: 54

Peptide Sequence: Synthetic peptide located within the following region: VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulointerstitial nephritis antigen

Protein Size: 476

Purification: Affinity Purified

• Artikelnummer: AVIARP55063_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55063_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27283
• Wirt: Rabbit