English
TKFC Antibody - N-terminal region : Biotin
TKFC Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55278_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAK
Key Reference: Diao,F., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (28), 11706-11711
Molecular Weight: 59kDa
Peptide Sequence: Synthetic peptide located within the following region: MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: triokinase/FMN cyclase
Protein Size: 575
Purification: Affinity Purified
Description of Target: This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAK
Key Reference: Diao,F., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (28), 11706-11711
Molecular Weight: 59kDa
Peptide Sequence: Synthetic peptide located within the following region: MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: triokinase/FMN cyclase
Protein Size: 575
Purification: Affinity Purified
| Artikelnummer | AVIARP55278_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55278_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 26007 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
