TLK2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The Tousled-like kinases, first described in Arabidopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TLK2

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: SNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase tousled-like 2

Protein Size: 718

Purification: Affinity Purified

• Artikelnummer: AVIARP58343_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58343_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11011
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin