TM9SF1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TM9SF1 may function as channel, small molecule transporter or receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TM9SF1

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane 9 superfamily member 1

Protein Size: 489

Purification: Affinity Purified

• Artikelnummer: AVIARP58962_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58962_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10548
• Wirt: Rabbit
• Konjugat: Conjugated, FITC