TM9SF1 Antibody - C-terminal region : HRP

TM9SF1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58962_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TM9SF1 may function as channel, small molecule transporter or receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TM9SF1

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane 9 superfamily member 1

Protein Size: 489

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58962_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58962_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10548
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×