TMED10 Antibody - middle region : Biotin

TMED10 Antibody - middle region : Biotin
Artikelnummer
AVIARP58728_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TMED10 is involved in vesicular protein trafficking.This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking. The protein is also a member of a heteromeric secretase complex and regulates the complex's gamma-secretase activity without affecting its epsilon-secretase activity. Mutations in this gene have been associated with early-onset familial Alzheimer's disease. This gene has a pseudogene on chromosome 8.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMED10

Key Reference: Dolcini,V., (2008) Biochem. Biophys. Res. Commun. 371 (1), 69-74

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane emp24 domain-containing protein 10

Protein Size: 219

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58728_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58728_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10972
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×