Tmem173 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmem173

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial transmembrane protein 173 EMBL AEM66211.1

Protein Size: 379

Purification: Affinity Purified

• Artikelnummer: AVIARP59031_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59031_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 498840
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin