TMLHE Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane. The encoded prot

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMLHE

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trimethyllysine dioxygenase, mitochondrial

Protein Size: 421

Purification: Affinity Purified

• Artikelnummer: AVIARP57145_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57145_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55217
• Wirt: Rabbit