TMOD2 Antibody - N-terminal region : HRP

TMOD2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55080_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMOD2

Key Reference: Pawlak,G., (2004) Int. J. Cancer 110 (3), 368-373

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tropomodulin-2

Protein Size: 351

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55080_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55080_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29767
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×