TNFSF13B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF13B

Key Reference: Xing,X.W., (2003) Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35 (3), 283-288

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor necrosis factor ligand superfamily member 13B

Protein Size: 285

Purification: Affinity Purified

• Artikelnummer: AVIARP58542_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58542_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10673
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin