TNFSF13B Antibody - N-terminal region : FITC

TNFSF13B Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58542_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF13B

Key Reference: Xing,X.W., (2003) Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35 (3), 283-288

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor necrosis factor ligand superfamily member 13B

Protein Size: 285

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58542_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58542_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10673
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×