TNFSF4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF4/OX4. It is found to be involved in T cell antigen-presenting cell (APC) interactions. In surface Ig- and CD40-stimulated B cells, this cytokine along with CD70 has been shown to provide CD28-independent costimulatory signals to T cells. This protein and its receptor are reported to directly mediate adhesion of activated T cells to vascular endothelial cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNFSF4

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor necrosis factor ligand superfamily member 4

Protein Size: 183

Purification: Affinity Purified

• Artikelnummer: AVIARP59092_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59092_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7292
• Wirt: Rabbit
• Konjugat: Conjugated, FITC